Sermorelin 5mg

For Research Purposes Only, Not For Human Consumption

$80.00

Sermorelin

Intended for laboratory research purposes only. Not for human consumption

Sermorelin is a synthetic analog of growth hormone-releasing hormone (GHRH), corresponding to the first 29 amino acids of native human GHRH (GRF 1-29 NH₂) with C-terminal amidation.

Key Chemical Details:

  • CAS Number: 86168-78-7 (free base/peptide; acetate salt often 114466-38-5)

  • Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S

  • Molecular Weight: 3357.88–3357.9 g/mol (commonly listed as 3357.9 or 3357.88; exact monoisotopic mass ≈3355.82 Da)

  • Amino Acid Sequence (one-letter code): YADAIFTNSYRKVLGQLSARKLLQDIMSRQ (C-terminal amidated)

  • Full sequence (three-letter code): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-NH₂

  • N-terminal: Tyrosine (Tyr); C-terminal: Amidated Glutamine (Gln-NH₂)

  • IUPAC/Full Chemical Name: (Complex systematic name for the 29-residue amidated peptide; e.g., L-tyrosyl-L-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-asparaginyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucylglycyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-isoleucyl-L-methionyl-L-seryl-L-argininamide—or variants; see PubChem for complete string)

  • PubChem CID: 16132413 (primary for Sermorelin; related entries for acetate salt)

  • Appearance (typical research grade): White to off-white lyophilized powder

  • Solubility: Readily soluble in water or aqueous buffers

  • Storage: Typically -20°C (as lyophilized powder for stability); avoid repeated freeze-thaw cycles and protect from light/moisture

  • Other Properties:

    • Shortened GHRH fragment retaining full GH-releasing activity with improved stability over full-length GHRH

    • High polarity from numerous charged (Arg, Lys, Asp, Glu) and polar (Asn, Gln, Ser, Thr) residues

    • Contains one methionine (Met) residue (contributing to the S atom in formula)

    • Sensitive to proteases (shorter chain offers some resistance), heat, light, and extreme pH

Disclaimers 

  • Strictly for qualified laboratory research professionals.

  • Not FDA-approved in this context; no therapeutic, diagnostic, or human-use applications.

  • Purity typically ≥98–99% (HPLC); batch-specific third-party Certificates of Analysis (COAs) available for identity, purity, and contaminants.

  • Handle according to standard lab safety protocols.